Protein Info for Pf6N2E2_179 in Pseudomonas fluorescens FW300-N2E2
Annotation: Integration host factor alpha subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to IHFA_PSE14: Integration host factor subunit alpha (ihfA) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 97% identity to pfv:Psefu_2750)Predicted SEED Role
"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A075P871 at UniProt or InterPro
Protein Sequence (100 amino acids)
>Pf6N2E2_179 Integration host factor alpha subunit (Pseudomonas fluorescens FW300-N2E2) MGALTKAEMAERLYEELGLNKREAKELVELFFEEIRHALEDNEQVKLSGFGNFDLRDKRQ RPGRNPKTGEEIPITARRVVTFRPGQKLKARVEAYAGTKS