Protein Info for Pf6N2E2_1787 in Pseudomonas fluorescens FW300-N2E2

Annotation: ribosomal protein S6 glutaminyl transferase related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF14401: RLAN" amino acids 1 to 96 (96 residues), 79.2 bits, see alignment E=5.4e-26 PF02655: ATP-grasp_3" amino acids 204 to 377 (174 residues), 24.7 bits, see alignment E=4.4e-09 PF08443: RimK" amino acids 206 to 383 (178 residues), 36.5 bits, see alignment E=7.9e-13 PF07478: Dala_Dala_lig_C" amino acids 230 to 382 (153 residues), 35.5 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfs:PFLU2732)

Predicted SEED Role

"ribosomal protein S6 glutaminyl transferase related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>Pf6N2E2_1787 ribosomal protein S6 glutaminyl transferase related protein (Pseudomonas fluorescens FW300-N2E2)
LTRKSLYSLALDDLDKALDKALNNHLYSNTEGFTLTLYFGKTNLEPLQELARQIFEIFPC
PILLVEFRKSNSWHIEGIKPGVLQKLREDQEDQFANSLDSFSRKIWRVPRSPRMARYDLA
ILHDPQESLPPSNAKALENFIRVGKGLGIDVDLIEKKDYSRIAEYDALLIRETTSVDNHT
YRFAKKAESEGLVVMDDPASILRCTNKVYLTDLLKSHQLGMPATEILYKERPEDFERVGE
RLGFPLVLKIPDGCFSRGVIKVESQQALLDATSELFEHSVLLLAQEFFYTEYDWRIGVLN
RKPIFACQYFMSKGHWQIYNHKAKGQDINGECRTLAVHEAPRAVVELAVKTANLIGDGLY
GVDLKQSGDKVVVIEVNDNPNMDAGIEDAYLQDDLYSLVLEEFIRRLELKRRGQAW