Protein Info for Pf6N2E2_1785 in Pseudomonas fluorescens FW300-N2E2

Annotation: HDIG domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF11871: DUF3391" amino acids 2 to 132 (131 residues), 83 bits, see alignment E=4.4e-27 PF13487: HD_5" amino acids 161 to 317 (157 residues), 107.7 bits, see alignment E=8.6e-35 TIGR00277: HDIG domain" amino acids 162 to 255 (94 residues), 33.2 bits, see alignment E=1.9e-12 PF01966: HD" amino acids 164 to 286 (123 residues), 56.1 bits, see alignment E=6.9e-19

Best Hits

Swiss-Prot: 56% identical to CDPD1_PSEAE: Cyclic di-GMP phosphodiesterase PA4108 (PA4108) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a2243)

Predicted SEED Role

"HDIG domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUF3 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Pf6N2E2_1785 HDIG domain protein (Pseudomonas fluorescens FW300-N2E2)
VLKHIGVTDLCVGMYVQELSGSCVERPFWSKGFLIQNEEVLEKVIASDIDGAWIDLSKGV
DVQASAPAETTVQAQQSPRLPTRSCTEVPGPRPRVAMSEELLRAVNLCSSSKAAVMEMFG
DLRMGRIVQLDRVTDMVGEISDSLLRHPDALLSLVRLKTADEYTYMHSVAVCGLMIGLAR
QLDLPPLLVQEAGLAGLLHDVGKMVIPTAILAKPLPLNDTEHMTMRTHPEAGARMLADSR
YFTSRVQDVCLHHHEKVDGSGYPHKLCGTQISLFARMAAVCDVYDAVTSDRPYRDRWGPA
ESIRKMAGWSGHFDQKVFHAFVKCIGIYPVGALVRLQSGRLAVVMEQHADYLLTPRVKVF
YSASSRVPLPPECIDLACGQDSIVSIESEKTWGFKSLEALWVATGQGSESRFG