Protein Info for Pf6N2E2_1783 in Pseudomonas fluorescens FW300-N2E2
Annotation: Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 38% identical to PILG_PSEAE: Protein PilG (pilG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 100% identity to pba:PSEBR_a2245)Predicted SEED Role
"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0N9WQ77 at UniProt or InterPro
Protein Sequence (122 amino acids)
>Pf6N2E2_1783 Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY (Pseudomonas fluorescens FW300-N2E2) MSKTILIVDDSASIRQVVSITLKGAGYEVIEGVDGRDALTKLDGRKIHLIVSDVNMPNMD GLSFIKAAKQLPAYKFTPVIMLTTETGEAMKQQGQAVGAKAWMVKPFQPAQMLGAVSKLI MP