Protein Info for Pf6N2E2_1774 in Pseudomonas fluorescens FW300-N2E2

Annotation: DNA-binding response regulator, LuxR family, near polyamine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF00072: Response_reg" amino acids 5 to 116 (112 residues), 97.8 bits, see alignment E=4.3e-32 PF00196: GerE" amino acids 147 to 203 (57 residues), 71.6 bits, see alignment E=3.3e-24

Best Hits

Swiss-Prot: 34% identical to UVRY_ECOLI: Response regulator UvrY (uvrY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2252)

Predicted SEED Role

"DNA-binding response regulator, LuxR family, near polyamine transporter" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZUE5 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Pf6N2E2_1774 DNA-binding response regulator, LuxR family, near polyamine transporter (Pseudomonas fluorescens FW300-N2E2)
MIRLMVADDHTIMREGLKQLFALVKDFSVVAEAENGAQVLELLRHTDIDVLLLDMTMPGS
SGEDLIGRIHAHYPKLPMLILSMHNEAHIAQRALRAGASGYMTKDRDPEALLAAIRKVST
GARYLDPQLAEQIALQSSGVTPENASQSLTSREFQILRMLAQGLSVNQIAEQLVISNKTV
STHKTRLMEKMCFATSTDLVRYALNEGLV