Protein Info for Pf6N2E2_1773 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 998 TIGR00229: PAS domain S-box protein" amino acids 115 to 238 (124 residues), 78 bits, see alignment E=3.4e-26 amino acids 522 to 648 (127 residues), 30.3 bits, see alignment E=2e-11 PF00989: PAS" amino acids 117 to 228 (112 residues), 44.1 bits, see alignment E=6.8e-15 amino acids 658 to 766 (109 residues), 24.9 bits, see alignment E=6.1e-09 PF13188: PAS_8" amino acids 118 to 169 (52 residues), 18.9 bits, see alignment 4e-07 amino acids 525 to 577 (53 residues), 21.5 bits, see alignment 6e-08 amino acids 658 to 703 (46 residues), 15.6 bits, see alignment 4.2e-06 PF13426: PAS_9" amino acids 130 to 230 (101 residues), 43.5 bits, see alignment E=1.1e-14 amino acids 551 to 641 (91 residues), 24 bits, see alignment E=1.3e-08 amino acids 665 to 768 (104 residues), 19.3 bits, see alignment E=4.1e-07 PF08447: PAS_3" amino acids 141 to 222 (82 residues), 47.4 bits, see alignment E=6.6e-16 PF08448: PAS_4" amino acids 251 to 357 (107 residues), 24.8 bits, see alignment E=7.9e-09 amino acids 531 to 642 (112 residues), 37.5 bits, see alignment E=8.7e-13 amino acids 660 to 770 (111 residues), 48.7 bits, see alignment E=2.9e-16 PF07730: HisKA_3" amino acids 797 to 863 (67 residues), 56.7 bits, see alignment 9.9e-19 PF02518: HATPase_c" amino acids 904 to 993 (90 residues), 43.7 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a2253)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVW1 at UniProt or InterPro

Protein Sequence (998 amino acids)

>Pf6N2E2_1773 Sensory box histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MDSAIALATPYTQGADDVGVLLLDAQGALLIMDDCASGLLGLSETAAFLVPLPSLFSLKP
LMFEQHITHARLKGSWHFQGMSADGDTLSVKLDYKAQQSTYLVKIHRAEHIHLAEQDYRL
AFDSAGTGLALLRMNGEWIAANRMLCQMLGYTEEELRATSFQRLTHPDDADLNKEELHRL
IQGHRASLTLEKRYIRKDGSTLWARLTVGIARNADAEALYFVSQLEDISEHLALRQALFN
NEQKYLSLAKSSQNIILRYNRLGQQIYANPELERARGFPNTHITERASTPNQLDEYFRTQ
VELTLSTGVANTFLLENKDSHSRRSMDFLCNLTPEHDETGKLCGVLVTAQDISALRRQER
AENARSAIFQKMVTHDSLLEVLPLLGAYLDILTPEFHNAMAFKAIPGDDSPDAPPTDTPS
IATCLAEDLDRHPELFEHHRFIADLRSDASGFAFSQPAVQAGYRGCWVEPVINKTGVTLG
AILLFVGGDTPLSEQDRKHAQMASHIAAIAWERCSAHSHLAQSERRYREVFDHSQDMLCL
LAVDADQQLSCLEANPKLCEMLAKSHSDMIGQPLGQCLEKEAASIVEAICLHCIAVGAPI
ELDAHLPCGQRSLVVHFNLVPVADSNGHLHRLVCIARNITDIREAQRNELARQQEIGTLV
ENSPDGIARLSRTGELLFINPALETWLDRPQIDLLHKDLLEILPKNLQSQLFHAAVIEAV
EKGQPLEHEYVLTEQHRLQRVYHISLVPEQDIQGKIATVLAVVRDISQLRLAELRLASLN
KQLRQLMSSRESAREEERKLIAQEIHDELGQHLTAIRMGTSLLRFQYGEQLPQLSEQVAR
LLQLIDQTVQVVRNISTSLRPSILNMGIAASLEWLTDTFKQQWGIDCNLQIHPPTIRLDD
ASATAAFRIAQESLTNIARHAEATRVNITFEQGDNGWSLEIADNGKGFEQREQSSRTLGL
LGMRERGLTLGGTTTISSSIGSGTTVQLRVPVSRSHDS