Protein Info for Pf6N2E2_1762 in Pseudomonas fluorescens FW300-N2E2

Annotation: putative lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00135: COesterase" amino acids 59 to 169 (111 residues), 32.1 bits, see alignment E=1.3e-11 PF20434: BD-FAE" amino acids 61 to 168 (108 residues), 54.6 bits, see alignment E=2.3e-18 PF07859: Abhydrolase_3" amino acids 72 to 279 (208 residues), 220.2 bits, see alignment E=5.6e-69 PF00326: Peptidase_S9" amino acids 144 to 298 (155 residues), 22.9 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 44% identity to bge:BC1002_5819)

MetaCyc: 58% identical to 4-hydroxyphenylacetate hydrolase (Pseudomonas fluorescens ACB)
3.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z3R2 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Pf6N2E2_1762 putative lipase (Pseudomonas fluorescens FW300-N2E2)
MPLDIESVKLINTLVELGLKPIHQMTPAEARGVMKFGRSVMQGPTMHRIEDVQLATARLR
VYVPSESTCGVMLYLHGGGWVLGELEDFDHFARVLAQKSACTVVLLEYRLAPEFPYPAAL
SDVELAHQWINDHRHRLTGSDLAPLIIAGDSAGGNLAAASAQRAMNSELARWDIQVLIYP
VTQSNLNSPAYQATDRQLLLSHEDMRWFWNHYLNEPSQRAQPNASPLAADDLSGLPPAIV
ITAELDVLREEGEAYVDRLRTAGIEVSHRRFEGQMHGFMTFMTLRASDQALDWVADQIAQ
RLRLL