Protein Info for Pf6N2E2_1757 in Pseudomonas fluorescens FW300-N2E2

Annotation: glutamine ABC transporter ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 transmembrane" amino acids 17 to 44 (28 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 191 to 216 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 115 (101 residues), 64.7 bits, see alignment E=4.4e-22 PF00528: BPD_transp_1" amino acids 35 to 220 (186 residues), 56.4 bits, see alignment E=5e-19 PF00005: ABC_tran" amino acids 277 to 429 (153 residues), 115 bits, see alignment E=6.4e-37

Best Hits

KEGG orthology group: None (inferred from 67% identity to kpu:KP1_4237)

Predicted SEED Role

"glutamine ABC transporter ATP-binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWA7 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Pf6N2E2_1757 glutamine ABC transporter ATP-binding component (Pseudomonas fluorescens FW300-N2E2)
MQFEWPYFFSLFSVSDFWKACITVVELSTLAWFIGMLLGFLLASAKLSATRWISVPASVY
IWFFRSVPLLVLVVFVYNLPQMFPITRGVLSNPFYSGLFALVVTEAAYMAEIHRGGLISV
AKGQKEAGRALGIGLIGLQRLIVIPQAFRISLPTLINEYITVVKLTSLVSVISLTELLTV
GQRLYAQNFLVMETLSAVAVYYVLIVTVLGWLFHWLEQHLELNNRKPQTLDDISLRRLRA
SQATPSSADAHTASGPGSAPALQLVNIHKRYGQHAVLKGINLDVNVGQVISIIGPSGSGK
TSLIRTVNALESIDQGEIILFGESYIHAGDNTNTQQVRHGVQRIGMVFQSFNLFPHRTIL
DNVTLAPRYHGRDKSISEQRAYALLDKVGLLAHAQKYPHQLSGGQQQRVAIARALAMDPH
IMLFDEPTSALDPELVGDVLKVISDLAKEGMTMLIVTHEMDFAMSISDRVVFMEDGLVKL
DAKPGMIRADQCGERIRKFMRV