Protein Info for Pf6N2E2_1750 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 PF00158: Sigma54_activat" amino acids 335 to 501 (167 residues), 225.2 bits, see alignment E=8e-71 PF14532: Sigma54_activ_2" amino acids 341 to 506 (166 residues), 69.3 bits, see alignment E=8.1e-23 PF07728: AAA_5" amino acids 358 to 475 (118 residues), 24.6 bits, see alignment E=4.4e-09 PF02954: HTH_8" amino acids 600 to 630 (31 residues), 35.8 bits, see alignment (E = 1.1e-12)

Best Hits

KEGG orthology group: None (inferred from 66% identity to ppw:PputW619_2694)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZY16 at UniProt or InterPro

Protein Sequence (640 amino acids)

>Pf6N2E2_1750 Sigma-54 dependent transcriptional regulator (Pseudomonas fluorescens FW300-N2E2)
MTRHSAQPHPSELAAFVNEHFPERRIRPDRVIAQSWYRSVIKHRLDPSSSARLDVLCAED
IRQHQQRHQQYLDIASQGVSGLARRVVPAGFAVLLSDEHGITLDARLPDQPVPYVRSGLV
VGARWDESIAGTNGIGTTLAAAEPLIIHREEHFLTSNARLSCSVAPIFNAQGLLQGCLNA
TCLNSNGPKESQYLTLQLVILYARLIENAHFRQNYRDRLTLSLKPIDEIADLANEQLLAL
DDSGRVIGANHAAFVAHDQAHGPHLLGGPIEQLLPMGVNELLRLTNGGARGLRLRARHDE
ALLDLSLRIPSSDHRLAPAPAKAQRPRHPDLEQLAGDDPTLQQAVRRLHKVIDKDIAILI
TGETGTGKEAFARAIHQASARRDEPFIALNCAAIPESLIESELFGYRGGSFTGADKKGMK
GKLELANGGTLFLDEIGDMPAHLQTRLLRVLAEREISPIGAPMPVSLDIQVICATHQDLQ
GMLRDKHFREDLFYRLNGMNLSLPPLRERSDRAQLIQRLLDSQAEAKGVQLTAQARQCLL
EASWPGNIRQLINALRYAVAMAEDGNVDVDCLPAELLQGDAYARLASPSVGSEPPASNLL
EILRRHRWNISAAAAELGVARSTLYRQMKKQRLVQPNDRL