Protein Info for Pf6N2E2_1747 in Pseudomonas fluorescens FW300-N2E2

Annotation: 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 1 to 156 (156 residues), 55.2 bits, E=1.7e-18
• PF00106: adh_short
  • amino acids 3 to 188 (186 residues), 169.5 bits, E=1.3e-53
• PF01370: Epimerase
  • amino acids 3 to 66 (64 residues), 24.6 bits, E=3.2e-09
• PF13561: adh_short_C2
  • amino acids 9 to 234 (226 residues), 203.1 bits, E=1.1e-63

Best Hits

Swiss-Prot: 32% identical to LINX_SPHJU: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase LinX (linX) from Sphingobium japonicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)

KEGG orthology group: None (inferred from 62% identity to agr:AGROH133_14245)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• palmitate biosynthesis III (28/29 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• anteiso-branched-chain fatty acid biosynthesis (30/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (30/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (23/25 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (12/12 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• biotin biosynthesis I (13/15 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• stearate biosynthesis IV (4/6 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A159ZW99 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Pf6N2E2_1747 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) (Pseudomonas fluorescens FW300-N2E2)
MYIVTGGTQGIGAATVEKLASLGHPVVFTGRDQSAGTQLAASLPNCTFVAGDVSNEDECR
NVVATALQLGNGKLAGLVNNAGMSGRKAFIETTQQEWDTLFAVNTRSVFFYTKHALPGLI
AGRGAVVNVSSIAGKTGEQGLATYCASKAALLGLTQALALEYGGQVRFNAVCPGQIATRM
MDKIVNDEARLSALTARIPEGRLASAREVAEAICWLLSPGASYVNGTTLTVDGGETAGLL
SPES