Protein Info for Pf6N2E2_1746 in Pseudomonas fluorescens FW300-N2E2

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 208 to 209 (2 residues), see Phobius details amino acids 237 to 260 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 259 (177 residues), 48.4 bits, see alignment E=4.9e-17

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 61% identity to agr:AGROH133_14237)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXY7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Pf6N2E2_1746 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Pseudomonas fluorescens FW300-N2E2)
MNHFTLCFVGRHLMRLFGIVMIVFMIAPLLAVVPISFSSGTFLSYPLPGLSLRWYEKVFS
AGPWLQALRNSLLVGCAATLLATLLGTLAALAFARRNLPGATHVLALLISPMIIPPVISG
LGMYFLFGQLGLTGTLTGMILAHTVLATPFVLINVAASLQGLDMSLLRAAAMSGASPVRA
FIDVGLPIIAPGVISGALFAFMTSFDEIVVVLFIGGPGQRTLPRQMFDGIRDTIDPSIVA
MSSFLLVVGLAGLLTTTWLSMRSSRTLNQSVA