Protein Info for Pf6N2E2_1740 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transketolase, C-terminal section (EC 2.2.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 76 to 99 (24 residues), see Phobius details PF02779: Transket_pyr" amino acids 26 to 180 (155 residues), 126.5 bits, see alignment E=9.4e-41 PF02780: Transketolase_C" amino acids 195 to 316 (122 residues), 102 bits, see alignment E=2.3e-33

Best Hits

Swiss-Prot: 39% identical to TKTC_METJA: Putative transketolase C-terminal section (MJ0679) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 72% identity to xau:Xaut_2041)

Predicted SEED Role

"Transketolase, C-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z3J6 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Pf6N2E2_1740 Transketolase, C-terminal section (EC 2.2.1.1) (Pseudomonas fluorescens FW300-N2E2)
MSAPVNPKSWQYRQLNAINPGLDYLSEGLLDLVADGHPIAVGTADLQYSNGLNRFAEKHP
ELFIQFGIAEQNMVSAAAGIATTGTMPFVATFASFLALLCCEQIRMDVAYSALPVRLIGH
HTGISLGFYGTSHHATEDIAIMRSIADLTVVAPADGPQLAAAIRASIHHPQPIYFRIGRG
QEPIVYRDDVTFTFGKAIVHSVGHDVTLIATGSMLHPTLEAAKALTDSGIAVGVIDMHTL
KPIDREAILNAATGTNLLITVEEHNVLGGLGGAVAEVLADEGAGVRLVRHGIHDEYSLIA
PPTHLYRHYRLDAAGIEAVTREALTTLSGKGQHHVG