Protein Info for Pf6N2E2_174 in Pseudomonas fluorescens FW300-N2E2

Annotation: Translation initiation factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR00168: translation initiation factor IF-3" amino acids 13 to 176 (164 residues), 219.4 bits, see alignment E=1.1e-69 PF05198: IF3_N" amino acids 13 to 78 (66 residues), 108 bits, see alignment E=2.2e-35 PF00707: IF3_C" amino acids 89 to 174 (86 residues), 122.9 bits, see alignment E=4.2e-40

Best Hits

Swiss-Prot: 99% identical to IF3_PSESY: Translation initiation factor IF-3 (infC) from Pseudomonas syringae pv. syringae

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 99% identity to pfl:PFL_2112)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C1ZW62 at UniProt or InterPro

Protein Sequence (177 amino acids)

>Pf6N2E2_174 Translation initiation factor 3 (Pseudomonas fluorescens FW300-N2E2)
MRQDKRAAPKAPINENISAREVRLIGADGEQIGIVSIDEALRIAEEAKLDLVEISADAVP
PVCRVMDYGKSIFEKKKQIAAAKKNQKQIQVKEIKFRPGTEEGDYQVKLRNLVRFLSDGD
RAKVSLRFRGREMAHQELGMELLKRVEQDLLEYGSVEQHPKMEGRQLIMVIAPKKKK