Protein Info for Pf6N2E2_1725 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensory box histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 TIGR00229: PAS domain S-box protein" amino acids 266 to 388 (123 residues), 66 bits, see alignment E=1.8e-22 PF08448: PAS_4" amino acids 276 to 383 (108 residues), 23.6 bits, see alignment E=2e-08 PF14598: PAS_11" amino acids 281 to 368 (88 residues), 29.6 bits, see alignment E=2.2e-10 PF13426: PAS_9" amino acids 285 to 381 (97 residues), 38.6 bits, see alignment E=4.5e-13 PF08447: PAS_3" amino acids 298 to 375 (78 residues), 45.5 bits, see alignment E=2.9e-15 PF00512: HisKA" amino acids 526 to 595 (70 residues), 29.9 bits, see alignment E=1.9e-10 PF02518: HATPase_c" amino acids 641 to 735 (95 residues), 67.8 bits, see alignment E=4.3e-22

Best Hits

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2266)

Predicted SEED Role

"Sensory box histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW83 at UniProt or InterPro

Protein Sequence (761 amino acids)

>Pf6N2E2_1725 Sensory box histidine kinase (Pseudomonas fluorescens FW300-N2E2)
MISTTVRLHGWLRLQREGMALAACADALCRALQDCAQIRRAIYLSWHAPSGIYRHEGRAR
HLPPGFGEALQSSDRALFQRLQDEERLELAQVRQLDCWLAGRLRRAALEHGQVLALALQP
GQQGLLLVELQPEVGQDWLVAVHELLSLLLASVSGQLRDSPLLGHDPQPSALLDSRGRPL
ELNEALLALLEQLSLVDASSLLPVSHAHLVQACLTQQRAIENVEVQVAEQILVWTFIPDP
KANRVLARCRQATAQILAERESAKARRLYRLITENTTDLISRHTPDGCFLDASLASWTLL
GYWPQELHGRQAHTLFHRQDQAGLMQRTRDALEQDGYHTMTYRIRHRDGHYLWFETACRA
IRETYTGAVVEVVSVSRDITARVQAEENKRRLAEVVEANTDPVLFIQPDGAVTYLNPAAR
RTLGLDAQHSLPTLDAFLSAEVLASLEQEGWDYAERSGRWSIEARLQPPAGGASVPVSLM
LLAHRAASGERFYSLVAHDQSERELREAQQRHHQDELAHTARLVTLGELASGIAHEMNQP
LAAVVNYANASQRYLQALGSHSEAAEKVAQGLERIAVHANHASEVIKRLRAFLRKGRRRM
EALDLSDVARATTRLCLWEASSCQVEIVERLPDNLPLVYADRVLLEQVLLNLLRNAIEAN
REAHPGQPSQIVLAVEPGADGGVQVSVSDQGHGVPTAQLEQIFTPFYSSKVNGLGLGLSM
SRSIIEGFGGELQARPLAVGLQMRCNLPGPTLAGVVRQQEE