Protein Info for Pf6N2E2_1712 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 239 to 256 (18 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 131 (125 residues), 73.2 bits, see alignment E=1.2e-24 amino acids 141 to 276 (136 residues), 73.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2277)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z3C8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>Pf6N2E2_1712 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens FW300-N2E2)
MPLKDSLLALLVAFLWGAQVTAVKIGGAELPPILMVAMRYAIMALFLLPLLKRVKREQFA
SVALIATITGTLHFGLLYCGIARVDASTSAIIYQLAAPFTLVLAFALLGEVLKLRLLAGI
VLAFAGVLVLLATPSAGGTFIGMLLVALAALAFAAGSVLTKRLGPLDPLALSAWTAVIAA
PQLLLWSFVQEGEQWTRVYTASAQAWWAVLYTALSGGLLGFGLWFWLLGRNSMQQLSPYL
LLVPVFAIVVSQVMLAEGFSQRLVIGAVLTLSGVALCQLRLPARFFLKAGSKGQGVADEP
R