Protein Info for Pf6N2E2_1711 in Pseudomonas fluorescens FW300-N2E2

Annotation: 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 43 to 272 (230 residues), 58.9 bits, E=7.3e-20
• PF00561: Abhydrolase_1
  • amino acids 47 to 277 (231 residues), 96.8 bits, E=2.5e-31
• PF12697: Abhydrolase_6
  • amino acids 48 to 282 (235 residues), 84.8 bits, E=2.2e-27

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2278)

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

• catechol degradation to 2-hydroxypentadienoate I (1/2 steps found)
• catechol degradation I (meta-cleavage pathway) (3/5 steps found)
• meta cleavage pathway of aromatic compounds (5/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (6/13 steps found)
• mandelate degradation to acetyl-CoA (9/18 steps found)
• naphthalene degradation to acetyl-CoA (3/12 steps found)
• superpathway of aerobic toluene degradation (14/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (10/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.9

Sequence Analysis Tools

See A0A159ZU10 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Pf6N2E2_1711 2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9) (Pseudomonas fluorescens FW300-N2E2)
MNRVDRLLLGTLRLVHRWQFGLKLRWHTGKHGRLAYLQSPARQQRTTLVMLHGLGASKDQ
WGPAMLGMARHHHCVFVDLPGHGQSVYEAGAGFGPLAMLAELEGLLDTLVEGPFVLVGSS
LGGCVAGLYAAKHPQRVSHLVLLAPAGLGEQALGPTLKASLQGAGTVFGYRTVEEMKRFW
SLVFQAPPEVGGRLAQAMAASGRSRFAAVQRVVEDFRREGLDVLLERLPQIAAKTLVIWG
RHDQVFLPATLDNLLKQLPDARGEFIEDCGHVPYLERGADVVTAITGFIATSRV