Protein Info for Pf6N2E2_1709 in Pseudomonas fluorescens FW300-N2E2

Annotation: multidrug resistance transporter, Bcr/CflA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 294 to 313 (20 residues), see Phobius details amino acids 319 to 341 (23 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details PF06609: TRI12" amino acids 24 to 190 (167 residues), 31.1 bits, see alignment E=1.4e-11 TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 25 to 400 (376 residues), 212.5 bits, see alignment E=6.6e-67 PF07690: MFS_1" amino acids 30 to 370 (341 residues), 155.9 bits, see alignment E=2.1e-49 PF00083: Sugar_tr" amino acids 59 to 133 (75 residues), 43.6 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 98% identity to pba:PSEBR_a2280)

Predicted SEED Role

"multidrug resistance transporter, Bcr/CflA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVR6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Pf6N2E2_1709 multidrug resistance transporter, Bcr/CflA family (Pseudomonas fluorescens FW300-N2E2)
MEARTSLAITATQPHASTQPLTGKVVALLAGLAAISMLSTNIILPAFAEIGKDLGVTARE
LGLTLSSFFITFALGQLVVGPLADRYGRQKLVLGGLSVFVVGTVIAGLATTLDVLIAGRV
VQALGVCAASVLSRAIARDLFEGETLARALSLTMIATAAAPGFSPLAGSVLSVTLGWRAI
FILVGLAAVVLAFFYVRDLGETHPADRRAPHSAKSVVLAYGRLALDKRFILPALSMSLLM
SGLFASFAAAPAILMQGIGLTSLQTGLYFAATVFVVFAAGMAAPRLAHRHGARIATLVGI
ACAMAGGGLLLVGPAAPGLGWYALSMITFLWGMGLANPLGTAITMGPFGKEAGMASALLG
FLSMGAAALSTWLASVLSFAPVTTLGGIQTMACLVALVLFLLRGRL