Protein Info for Pf6N2E2_1705 in Pseudomonas fluorescens FW300-N2E2

Annotation: Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00005: ABC_tran" amino acids 21 to 181 (161 residues), 107.7 bits, see alignment E=7.9e-35 PF12399: BCA_ABC_TP_C" amino acids 230 to 255 (26 residues), 37.7 bits, see alignment (E = 1.3e-13)

Best Hits

Swiss-Prot: 39% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 98% identity to pba:PSEBR_a2284)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWS0 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Pf6N2E2_1705 Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1) (Pseudomonas fluorescens FW300-N2E2)
MSALLEVRNVSLSFRGVKAISDLSFSVKLGEICALIGPNGAGKSSLLNILNGVYRADAGQ
LFFAAEPLHRPHPLKAARLGIGRTFQNNALFKKMSVVDNLLTGLSRFQRTFFLEQALGLP
RARREARAFAERAERVLEFLELQAWRDVAVGSLAYGLQKRVELGRALIAQPTLLLLDEPM
AGMNAEEKQDMSRFITDINRDLGTTVILIEHDIQVVMGLSSHVVVLDYGRKVGDGSPAEV
QVNPEVIAAYLGASHP