Protein Info for Pf6N2E2_1694 in Pseudomonas fluorescens FW300-N2E2

Annotation: FMN reductase (EC 1.5.1.29)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF03358: FMN_red" amino acids 6 to 150 (145 residues), 97.6 bits, see alignment E=5.4e-32 TIGR03566: FMN reductase" amino acids 6 to 177 (172 residues), 254.2 bits, see alignment E=3e-80 PF02525: Flavodoxin_2" amino acids 9 to 135 (127 residues), 31.7 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 76% identical to SFNE_PSEPU: NADH-dependent FMN reductase SfnE (sfnE) from Pseudomonas putida

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 95% identity to pba:PSEBR_a2295)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.29

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWR5 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Pf6N2E2_1694 FMN reductase (EC 1.5.1.29) (Pseudomonas fluorescens FW300-N2E2)
MSTPLKVVAVSGGTSRPSRTLALTEAILGELGQHLVIDTHLIELGNIARPLGGTLWRKEL
PETVEHELRLIESADLLVVAAPVYRGTYPGLFKHLFDLIGQDALVNTPVLLAATGGSERH
ALVLDHQLRPLFSFFQSLTLPIGVYASENDFADYRIVSKTLQSRIELAAGRAARLFAGQA
HALRKIA