Protein Info for Pf6N2E2_1688 in Pseudomonas fluorescens FW300-N2E2

Annotation: Permeases of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 310 to 333 (24 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF12832: MFS_1_like" amino acids 12 to 379 (368 residues), 59.3 bits, see alignment E=3.8e-20 PF07690: MFS_1" amino acids 18 to 294 (277 residues), 93.3 bits, see alignment E=1.5e-30 amino acids 224 to 402 (179 residues), 51.8 bits, see alignment E=6.3e-18

Best Hits

Swiss-Prot: 56% identical to Y2456_MYCTU: Uncharacterized MFS-type transporter Rv2456c (Rv2456c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a2307)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z399 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Pf6N2E2_1688 Permeases of the major facilitator superfamily (Pseudomonas fluorescens FW300-N2E2)
MDRNRDRRNNLSLDGLNFFLADVRDGLGPYLAIYLLAVHRWDPASIGVVMTVAAMAGLVA
QAPAGALIDRVRSKRAVVAVAALAVTLGCLVLPFTSSFGLVALTQAIGAVAASVFAPAIA
AISLGITGARAFTRRTGRNETFNHAGNACAALLAGGFAWLFGPIAVFYLMAAMALASIVA
VSCVSAEAIDHDVARGLEAGQLVHGPEPSTLRVLLDNRTLLLFAICCGLFHLANAAMLPL
VSQKLAQANVHLATPLTSACIVAAQLVMVPMAWLVGVKADVWGRKPLLLAGFLILPIRGV
LYVLSNDPYWLVAVQLLDGIGAGLFGALFPLVVKDLTQGTGRFNVSLGVLSTVFGFGAAL
SNSLAGFVVQGAGYSAAFLTLAAIAALAFGLLLAMPETFRPSRVTQADTLAVPDGGVA