Protein Info for Pf6N2E2_1662 in Pseudomonas fluorescens FW300-N2E2

Annotation: 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 74% identical to UGL_BURA4: Ureidoglycolate lyase (BamMC406_5393) from Burkholderia ambifaria (strain MC40-6)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2334)

MetaCyc: 78% identical to 2,4-didehydro-3-deoxy-L-fuconate hydrolase (Burkholderia multivorans)
RXN-12096 [EC: 3.7.1.26]

Predicted SEED Role

"5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase." in subsystem Aromatic amino acid degradation

MetaCyc Pathways

D-arabinose degradation IV (4/6 steps found)
L-arabinose degradation V (4/6 steps found)
D-xylose degradation VI (3/5 steps found)
L-fucose degradation III (4/8 steps found)
L-rhamnose degradation III (3/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z329 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Pf6N2E2_1662 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase. (Pseudomonas fluorescens FW300-N2E2)
MKLLRYGEKGSEKPGLLDADNQIRDLSAHVPDIAGQALGPDSLAALATLDPRSLPLVAGQ
PRIGACVGQVGKFICIGLNYADHAAESNMEVPREPIIFNKWTSAICGPNDDIQIPRGSLK
TDWEVELGVVIGKGGRYIDEANAMEHVAGYCVINDVSEREWQLERGGTWDKGKGFDTFGP
LGPWLVTRDEIADPHTLDLWLEVDGHRYQNGNTRTLIFSVPQLIAYLSRCMSLQPGDVIS
TGTPPGVGLGIKPNPVFLRPGQTMRLGIQGLGEQRQVTVQAD