Protein Info for Pf6N2E2_1650 in Pseudomonas fluorescens FW300-N2E2

Updated annotation (from data): Sucrose alpha-glucosidase (EC 3.2.1.48)
Rationale: Specifically important for utilizing Sucrose. Automated validation from mutant phenotype: the predicted function (3.2.1.48-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 TIGR01322: sucrose-6-phosphate hydrolase" amino acids 33 to 469 (437 residues), 451 bits, see alignment E=2.1e-139 PF00251: Glyco_hydro_32N" amino acids 39 to 335 (297 residues), 346.6 bits, see alignment E=1.6e-107 PF08244: Glyco_hydro_32C" amino acids 363 to 487 (125 residues), 99.4 bits, see alignment E=2.1e-32

Best Hits

KEGG orthology group: K01193, beta-fructofuranosidase [EC: 3.2.1.26] (inferred from 96% identity to pba:PSEBR_a2364)

Predicted SEED Role

"Sucrose-6-phosphate hydrolase (EC 3.2.1.B3)" (EC 3.2.1.B3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.26 or 3.2.1.48 or 3.2.1.B3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z2Z6 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Pf6N2E2_1650 Sucrose alpha-glucosidase (EC 3.2.1.48) (Pseudomonas fluorescens FW300-N2E2)
MTVSVNAMNAPMPSPLEHAQQALSEGQSRLIGDYRPAYHLAPVAGWMNDPNGVVFFRGEY
HVFYQHHPFDAKWGPMYWGHAKSTDLVHWQHLPLALAPGDDFDRHGCFSGSAVVCGDTLA
LIYTGHTWLGEVGDERFIRQVQCLATSDDGIRFVKHGAVIENAPQETIMHFRDPKVWRED
GYWYLIAGARLGDKPLLPLYRSTDLHTWDFLDYVSSGNEGDGYMWECPDLFRLNGCDVLL
YSPQGMKPEGYERLNKYQTGYRIGRLDSEWHFTGGPFIELDNGHDFYAAQTLETADGRRL
VWAWLDMWESPMPSQAHHWCGMLGLPRELELQGDRLGVFPARELTALRQAPLPSVAPWGE
SGSRWVPQVKGDRLEIHVHLDLLDCTEGHLGIALRCSTDEQEQTLLYYDASLQRLVLDRS
RSGAQVSGQRSVSIVPSQTQLHLRVFLDRSSIEVFEENGRFSFSSRLYPRPDSLGVKLLA
NGTGGRVAIPKAWPLDSGWL