Protein Info for Pf6N2E2_1648 in Pseudomonas fluorescens FW300-N2E2

Annotation: Maltose/maltodextrin ABC transporter, permease protein MalG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 244 to 265 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 272 (182 residues), 56.3 bits, see alignment E=1.8e-19

Best Hits

Swiss-Prot: 42% identical to SUGB_MYCTU: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to pba:PSEBR_a2366)

MetaCyc: 42% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWN0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Pf6N2E2_1648 Maltose/maltodextrin ABC transporter, permease protein MalG (Pseudomonas fluorescens FW300-N2E2)
MSPRLLKKALLRAGFWCLIGILLLYAVFPFYYAIVTSLKPSSALFQVSYWIDNPDFSNYA
AVLGQASFLRAIGNSLVVALCVVALALLLSLTAAYALGRVKFRGRGVVLMMVLGVSMFPQ
VAVLSGLFEVIRALGLYNTSWALILSYTIFTLPFTVWVLTTFMGQLPHELEEAAIMDGAS
PWVTLTRVLLPLLWPALVTTGLLAFIAAWNEFLFALTFTLTDSQRTVPVAIALISGGSPH
ELPWGLLMAASVLVTVPLVILVLIFQRRIVSGLTAGALKG