Protein Info for Pf6N2E2_1647 in Pseudomonas fluorescens FW300-N2E2

Annotation: Maltose/maltodextrin ABC transporter, permease protein MalF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 112 to 313 (202 residues), 69.5 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 36% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 99% identity to pba:PSEBR_c2g53)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVH6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Pf6N2E2_1647 Maltose/maltodextrin ABC transporter, permease protein MalF (Pseudomonas fluorescens FW300-N2E2)
MSVSTTLAPGDDEYLLNRETPVQRRRVRAAWLFLSPMLLCLALVAAWPLLRTFWFSLTDA
SLADTGDATFVGLSNYLFHSSAGWSGILVDPQWWNAVRNTLHFTVVSVGLEIVLGLMVAL
LLNVKFTGRALVRALILIPWAIPTIVSAKIWSWMLNDQFGIINHLMLGLGLIDAPLAWTA
DADLSMWAVIIVDVWKTVPFVTLLMLAALQMLPSDCYEAARVDGIHPVKVFWWVTLPLLM
PALLVAAIFRILDSLRVFDVIYVLTSNSSSTMSMSVYARQHLVEFQDVGYGSAASTLLFL
VVAVIAMAYLYLGRRQLEVRS