Protein Info for Pf6N2E2_1646 in Pseudomonas fluorescens FW300-N2E2

Annotation: Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 52 (52 residues), see Phobius details PF01547: SBP_bac_1" amino acids 69 to 360 (292 residues), 103.5 bits, see alignment E=2.3e-33 PF13416: SBP_bac_8" amino acids 71 to 381 (311 residues), 94.1 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 48% identical to UE38_DEIRA: Probable ABC transporter-binding protein DR_1438 (DR_1438) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 99% identity to pba:PSEBR_a2367)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW29 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Pf6N2E2_1646 Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE (Pseudomonas fluorescens FW300-N2E2)
MPHRKYTATFGDVNVNFSKNKNKEGFMKQLKSILPAALLGLCVGFPSLCTAASLTISCGA
VGAELQLCKEAVEAWSKQTGNSVEVVSTPNSATERLSFYQQILSAQSSDIDIIQIDMVWP
GMLAKHLMDLREVLPANATQGYFQAQVDNATVNGRLVTMPWFTDSGLLYYRKDLLEKYNK
PVPQTWEEMTTTARAVQQAERAAGNANAWGYVFQGRAYEGLTCNALEWISSQPQGGLVNQ
QGDIVVNSQASRAALTLAKSWVGDISPRGVLNYTEEEGRGVFQSGNALFMRNWPYVWALV
QSQDSVVKDKVGVAPLPRGGETGTHASTLGGWGLAVSRYSANPKLAAELVSYLSSAQQQK
HRALVGAYNPVIESLYQDPELLAAMPYYSQLRSILNDGVMRPASITADRYPRVSNAFFDQ
VHGVLADERPVDQALAELESELTRIKRRNW