Protein Info for Pf6N2E2_1633 in Pseudomonas fluorescens FW300-N2E2

Annotation: Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 250 to 280 (31 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details PF01032: FecCD" amino acids 34 to 345 (312 residues), 298.1 bits, see alignment E=3.3e-93

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 54% identity to mme:Marme_0965)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z2T6 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Pf6N2E2_1633 Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) (Pseudomonas fluorescens FW300-N2E2)
MMRAGLTLPRAYPLLPWIARPIDLISVLLLMVAVVALALYALTVGSYSLSVAQVWQALLA
PEQVNSTMRNLLWELRLPRVLLAVLAGAAMSLAGLLMQSLTRNPLAAPGLVGVESGASVT
MLLIIVLWPALLPLEFYPLAALAGGLAVAFFVALLSWRQGISPLRLILVGVGLTAMLSAV
ADLLITYGNIDQVESALMWLGGSLHRASWPQVHSLGLWLLVAGVPLLFCHRQLNLLQLGE
KVALSRGLNVTWIMVSLLLCSVMLTAAAVANVGTMTFVGLVAPHLARQMAGDRHGALIPL
SALVGALLVLAGDTLGRGLLPPLQLPAGLVVAIIGAPYLIVLLARQRSR