Protein Info for Pf6N2E2_163 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 129 to 140 (12 residues), see Phobius details amino acids 142 to 142 (1 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 300 to 316 (17 residues), see Phobius details PF02653: BPD_transp_2" amino acids 48 to 311 (264 residues), 179.1 bits, see alignment E=5e-57

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to pba:PSEBR_a3709)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YLA4 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Pf6N2E2_163 Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1) (Pseudomonas fluorescens FW300-N2E2)
MKTASAVGKSSGNFYGLGTYLGLAGALLAMVALFSALSSHFLSYDTFSTLANQIPDLMVL
AVGMTFILIIGGIDLSVGSVLALAASTVSVAVLGWGWSVWPSALLGMAVAALAGTVTGSI
TVAWRIPSFIVSLGVLEMARGLAYQMTGSRTAYIGDSFAWLSNPIAFGISPSFIIALLVI
FIAQAVLTRTVFGRYLIGIGTNEEAVRLAGINPKPYKILVFSLMGLLAGVAALFQISRLE
AADPNAGSGLELQVIAAVVIGGTSLMGGRGSVISTFFGVLIISVLAAGLAQIGATEPTKR
IITGAVIVVAVVLDTYRSQRASRRG