Protein Info for Pf6N2E2_1625 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ferric reductase (1.6.99.14)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR03951: siderophore-iron reductase FhuF" amino acids 58 to 235 (178 residues), 168.2 bits, see alignment E=1e-53 PF06276: FhuF" amino acids 62 to 209 (148 residues), 57.5 bits, see alignment E=2.5e-19 PF11575: FhuF_C" amino acids 215 to 235 (21 residues), 34.2 bits, see alignment (E = 1.8e-12)

Best Hits

KEGG orthology group: K13255, ferric iron reductase protein FhuF (inferred from 45% identity to hel:HELO_3305)

Predicted SEED Role

"Ferric reductase (1.6.99.14)" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWL3 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Pf6N2E2_1625 Ferric reductase (1.6.99.14) (Pseudomonas fluorescens FW300-N2E2)
MIPSLAPLFTGPLADHGEKLQLRSHPRTDVPGDRFFQHEYFGAFVDDLQARYKTDERLAL
VSLWSKWYFSTFLAPVMAANLLQQCDLPLALADTGIQLGNDARPQALHLLHAGQPLPPCT
AFERFHTLVEDHLEPVIETLVSVSQASPRLFWSNAGNTFEFVTSRIDLHPLANAYSTAPA
KEILNTRLRPNGRRNPLFAPVQYRDIGEDEPQRLRRICCIRYRLPGVGYCSSCPLDECKR
QEQPV