Protein Info for Pf6N2E2_162 in Pseudomonas fluorescens FW300-N2E2

Annotation: Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 24 to 174 (151 residues), 112.8 bits, see alignment E=1e-36 amino acids 274 to 429 (156 residues), 67.8 bits, see alignment E=8.4e-23

Best Hits

Swiss-Prot: 46% identical to RBSA3_RUBXD: Ribose import ATP-binding protein RbsA 3 (rbsA3) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 99% identity to pba:PSEBR_a3710)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YL95 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Pf6N2E2_162 Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1) (Pseudomonas fluorescens FW300-N2E2)
MSVRDPNAVLCVSGIGKTYAQPVLTDINLTLMRGEVLALTGENGAGKSTLSKIIGGLVTP
TTGQMQFQGQDYRPGSRTQAEELGVRMVMQELNLLPTLSVAENLFLDNLPNHGGWISRKQ
LRKAAIEAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTARE
VEMLFEQITRLQARGVSIIYISHRLEELARVAQRIAVLRDGNLVCVEPMANYNSEQLVTL
MVGRELGEHIDLGPRQIGAPALTVKGLTRSDKVRDVSFEVRSGEIFGISGLIGAGRTELL
RLIFGADTADSGTVALGSPAQVVSIRSPADAVAHGIALITEDRKGEGLLLTQSIAANIAL
GNMPEISSAGLVNGDAELALAQRQVDAMRIRSSSPTQLVSELSGGNQQKVVIGRWLERDC
AVMLFDEPTRGIDVGAKFDIYALLGELTRQGKALVVVSSDLRELMLICDRIGVLSAGRLI
DTFERDSWTQDDLLAAAFAGYQKRDALLNEAAPRDFS