Protein Info for Pf6N2E2_1613 in Pseudomonas fluorescens FW300-N2E2

Annotation: short-chain dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00106: adh_short" amino acids 11 to 189 (179 residues), 118.2 bits, see alignment E=4.9e-38 PF01370: Epimerase" amino acids 11 to 135 (125 residues), 21.6 bits, see alignment E=2e-08 PF13561: adh_short_C2" amino acids 14 to 245 (232 residues), 138 bits, see alignment E=6e-44

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfo:Pfl01_3470)

Predicted SEED Role

"short-chain dehydrogenase/reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZW03 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Pf6N2E2_1613 short-chain dehydrogenase/reductase (Pseudomonas fluorescens FW300-N2E2)
MSNEFKPGLSVVTGASSGIGLAVTQRLLEHGSNVIAMSRQIGGLGELVERFGDRLSWLPG
DVTQATDQARLAQLATSIGPVDCLVPNAGIAQLADGLDLAAFDRQWAVNGAGALNTLSSL
REHLAAEASVVFIGTFLEQVTFPGLAAYIASKAALRAQMRTLAVELAPLGVRLNMVSPGP
TATPIWGTLGLDAEALGSVASAVNQRLLNGQFLEPGAVADVILFQLSQGARGVYGQDWVV
DSGYTLR