Protein Info for Pf6N2E2_1611 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 74 to 97 (24 residues), see Phobius details amino acids 136 to 162 (27 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 114 to 271 (158 residues), 49.8 bits, see alignment E=1.8e-17

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 98% identity to pba:PSEBR_a2438)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z2P1 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Pf6N2E2_1611 Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1) (Pseudomonas fluorescens FW300-N2E2)
MLTRDTRDPATRPRLLLSLLALVLLWPGIQFSELDLGVLLKSDSQSEMGRFVAAFWPPAH
GDEFVELLWQATLQTLAIATAGMALALLLAVPASLLASRALSLSAASRAGHPGYWGQLLR
WPVRGLLIFLRSVPEIVWALLFVRAVGLGPTAGVLAIAITYSGMLGKVYAEIYESVDQRP
AHALLQSGSSRLAAFSYGILPNVAAELLSYTVYRWECAIRASVVMGFVGAGGLGQQMDLS
LRMFAGGEVASLLLTFLVLVLLADQLSRLLRWRLA