Protein Info for Pf6N2E2_1610 in Pseudomonas fluorescens FW300-N2E2

Annotation: Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00005: ABC_tran" amino acids 19 to 174 (156 residues), 99.4 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 80% identical to PHNC_PSEPF: Phosphonates import ATP-binding protein PhnC (phnC) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 98% identity to pba:PSEBR_a2439)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTU1 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Pf6N2E2_1610 Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1) (Pseudomonas fluorescens FW300-N2E2)
MTLQLTQVSVTHANGVQALRGIDLHIGAGEQVAIIGPSGAGKSSLLNLLATALRPGNGEL
QLLGERAWQLSARQRQRLRARIGLIHQSPPLPPRQRVVTAVLAGKLGQWGVGKSLLNLLH
PLDIPGARAALAQLDLGDKLFAQCQQLSGGQLQRVGIARVLYQAPEVLLADEPVSAMDPV
LAEHTLSVLCRHAREHNVTLVASLHAVELALAHFSRVIGLRDGQILFDLPTEAVDRPLLD
TLYANEQLQSSPTPPSSLSVQIPRC