Protein Info for Pf6N2E2_1584 in Pseudomonas fluorescens FW300-N2E2

Annotation: Transcriptional regulator, MarR family / Acetyltransferase (GNAT)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF12802: MarR_2" amino acids 16 to 74 (59 residues), 43.4 bits, see alignment E=1e-14 PF01047: MarR" amino acids 20 to 74 (55 residues), 36.5 bits, see alignment E=1.3e-12 PF09339: HTH_IclR" amino acids 30 to 61 (32 residues), 25.4 bits, see alignment 3.4e-09 PF13463: HTH_27" amino acids 33 to 83 (51 residues), 28.8 bits, see alignment 4.4e-10 PF00583: Acetyltransf_1" amino acids 179 to 273 (95 residues), 53.3 bits, see alignment E=1.2e-17 PF13673: Acetyltransf_10" amino acids 180 to 281 (102 residues), 43 bits, see alignment E=1.5e-14 PF13508: Acetyltransf_7" amino acids 190 to 274 (85 residues), 45.3 bits, see alignment E=3.2e-15

Best Hits

KEGG orthology group: None (inferred from 89% identity to pba:PSEBR_a2458)

Predicted SEED Role

"Transcriptional regulator, MarR family / Acetyltransferase (GNAT)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXQ0 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Pf6N2E2_1584 Transcriptional regulator, MarR family / Acetyltransferase (GNAT) (Pseudomonas fluorescens FW300-N2E2)
MVRELGFMHATLAATGYPPSSVHTIVELGHRQSLTAGELVELLGLEKSSVSRMVRKLVEA
GEIEEIAHEQDARAKRLRLTAQGQKTLRAIDAFATQQVVAAMSHLSSEQCQIVSAGIASY
AVALHAHRLGTEPPAPAPLEIARGYRPGVIGRIVQMHADYYSRHSNFGQLFESLVASDMA
ELMGRLHNPRNEVWVALNGERIVGSIAIDGEGEGGSAVLRCFILDDSARGKGAGRRLLAE
AMKFCDEWGFSSTSLWTFQGLEAARKLYEDFGFKLELEQEGQQWGRPVTEQCFVRPGPAV
SPI