Protein Info for Pf6N2E2_1583 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC-type protease/lipase transport system, ATPase and permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 13 to 556 (544 residues), 723.1 bits, see alignment E=1e-221 PF00664: ABC_membrane" amino acids 23 to 280 (258 residues), 44.7 bits, see alignment E=1.5e-15 PF00005: ABC_tran" amino acids 347 to 494 (148 residues), 91.2 bits, see alignment E=9e-30

Best Hits

Swiss-Prot: 54% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 73% identity to avn:Avin_16240)

Predicted SEED Role

"ABC-type protease/lipase transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWI5 at UniProt or InterPro

Protein Sequence (594 amino acids)

>Pf6N2E2_1583 ABC-type protease/lipase transport system, ATPase and permease components (Pseudomonas fluorescens FW300-N2E2)
MRSAPENSLKKALKACRDSFISVGFFSFFINALMLVPTFYMLQVYGRVITSGSLTTLTML
TLIMTALLVTLGSLEWIRSRVMVRVSTRLDVLLSRQVYRASFKRALESGGMDASAQSLND
LTGLRQFLSGNGLFAFFDAPWLPIYIAVMFLFHPWFGWVATGSALLLLVLAFVNERLTGP
VLAQANKEHIGATLYTTKSLRNAEVIESMGMLETLMDRWGRRQRNVLLLQSAASDSGAII
STLSRTFRILVQSLVLGLGAYLAVDHQVGAGLVFAGSVLLGRALAPIDLIIGSWKGFIAA
RSQYSRLNDILDKQQAQPERMSLPAPQGDVQVENLIVAAPGSRVPILKNISFSAPAGCMV
GVIGPSAAGKSTLARALLGVWAAQHGVVRLDGADISTWDKHELGPYIGYLPQDIELFEGT
LGENIARFAGVDSVKVIQAARIAGVHEMILQFPDGYDTVIGSEGLMLSAGQRQRIGLARA
LYGSPRLIVLDEPNSNLDDVGDRALAAAIQQLRQTGATLFVITHRTNIVSQLDRLMVMNA
GIISLYGPREHVLAELNAQRQQAQMPAVPASTGTASVDTGKGDSNESHGAQSSN