Protein Info for Pf6N2E2_1565 in Pseudomonas fluorescens FW300-N2E2

Annotation: FIG00961164: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF01040: UbiA" amino acids 28 to 237 (210 residues), 47.7 bits, see alignment E=6.6e-17

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 96% identity to pba:PSEBR_a2475)

Predicted SEED Role

"FIG00961164: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVG5 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Pf6N2E2_1565 FIG00961164: hypothetical protein (Pseudomonas fluorescens FW300-N2E2)
MNQTAPNLKTWLTLGRVSNLPTVWTNTLAAALLASSAGALAPPSSLVWILLLVALSLLYL
AGMLLNDLLDADWDQQHHNPRPITLGLVSRQHVRLATALLLVLAAASLLGLSQLIEQPHW
LLGSATLLVGCILGYNLLHKKYAHSVWLMGACRSALYLTAAASLAMPAGPIWLCAILLGV
YISGLTYLARQEHRNQLISRLPLLLMLSPLALAIYAGSTWFWPVLLLWLGWLGWHYWHNL
ANPRQRQVRAFIGAGLAALPLFDALVLAVANQPLGSLLCVAVFFLLPHFQRWIKPT