Protein Info for Pf6N2E2_1558 in Pseudomonas fluorescens FW300-N2E2

Annotation: Sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 564 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF00512: HisKA" amino acids 197 to 261 (65 residues), 44.2 bits, see alignment E=2.4e-15 PF02518: HATPase_c" amino acids 309 to 410 (102 residues), 79.3 bits, see alignment E=4.4e-26 PF00072: Response_reg" amino acids 437 to 541 (105 residues), 41.4 bits, see alignment E=2.1e-14

Best Hits

KEGG orthology group: None (inferred from 96% identity to pba:PSEBR_a2485)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161GTT7 at UniProt or InterPro

Protein Sequence (564 amino acids)

>Pf6N2E2_1558 Sensor histidine kinase/response regulator (Pseudomonas fluorescens FW300-N2E2)
MGQPLRYLKAPEAREVRKTVEKNSELDQATLRLTVSACALLYIVILAGLYPEDAASYVPI
IIYICMFIVVSVFLRMIIKRWPGHFFWRRLFTMLHDYAGIAFAMIVGGEGTLPVYAALLW
VTLGNGMRFGSRYLALATVIALSSLVLVFWLTPFWHTQPYMFLMLIVTTIVVPAYAHILL
KRTRIASEEAILANQEKSRFLAQASHDLRQPIHSIGLFTACLRDARLGQEELRLVDNIDR
SLHTVSQLFRSILDIYTLDHGQLIPKADTVHLGQLLQDVVKQNTEAARWAGVELRLRDCP
YWVSVNPGLLTTMVQNLLSNALKYAPGQPVLIGVRRQGKRLAVVIYDKGRGIAAEHLPEV
FKEFYRVRHMRDKDVEGLGLGLSIVKRISQMLDVDIHIRSKVGQGTRVAISGLEPAAPCV
MAPKGVPVGNRLDGLRVCLVEDDANVLMATSALLEKWGCEVEAHSDGEGLTSDCDIVIAD
FDLGTKVSGAECIAALREQRGRQVPALVITGHEIERIRQSLQSLSISVLAKPVRPPELRA
VLLELVKRMNRKGEASAHLNPPSR