Protein Info for Pf6N2E2_1553 in Pseudomonas fluorescens FW300-N2E2

Annotation: Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 22 to 36 (15 residues), see Phobius details PF02798: GST_N" amino acids 6 to 78 (73 residues), 59.2 bits, see alignment E=1.3e-19 PF13417: GST_N_3" amino acids 8 to 82 (75 residues), 51.9 bits, see alignment E=2.3e-17 PF13409: GST_N_2" amino acids 14 to 79 (66 residues), 58.3 bits, see alignment E=3e-19 PF00043: GST_C" amino acids 127 to 194 (68 residues), 37.1 bits, see alignment E=9.1e-13 PF13410: GST_C_2" amino acids 128 to 187 (60 residues), 36.7 bits, see alignment E=1.1e-12 PF14497: GST_C_3" amino acids 133 to 195 (63 residues), 28.7 bits, see alignment E=3.9e-10

Best Hits

Swiss-Prot: 62% identical to GSTA_RHILE: Protein GstA (gstA) from Rhizobium leguminosarum

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 99% identity to pba:PSEBR_a2490)

Predicted SEED Role

"Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZU01 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Pf6N2E2_1553 Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18) (Pseudomonas fluorescens FW300-N2E2)
MSEKAIKLYRHPLSGHAHRVELMLSLLGLPTELIFVDLMKGEHKTPEFLAINSFGQVPVI
DDNGTVLADSNAILVYLATKYGKGQWLPSDSLAQARVQRWLSVAAGQINQGPANARLITV
FGAGYDAEDAIKRSHALLKVMETELGQSRFLAGEQPTIADVAAYTYVSHAPEGNVALTDY
PNVRAWLGSIEALPNFVGMQRTAKGLQQA