Protein Info for Pf6N2E2_155 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 signal peptide" amino acids 5 to 5 (1 residues), see Phobius details amino acids 24 to 25 (2 residues), see Phobius details transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details PF09980: DUF2214" amino acids 5 to 148 (144 residues), 126.8 bits, see alignment E=3.4e-41

Best Hits

KEGG orthology group: K08983, putative membrane protein (inferred from 96% identity to pba:PSEBR_a3717)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165YKZ6 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Pf6N2E2_155 Probable transmembrane protein (Pseudomonas fluorescens FW300-N2E2)
MLAHWSLAAIHLLAFALGFWAVLTRGTALRRLAAGVDAVRNVLMADNLWGLSALVLLVTG
GMRAFAGYEKGTDYYLHQPLFHLKMTLFLLILLLEIAPMIALIKWRMALGKGAAIDPSKA
GRFARISHIEALLLILMVIAATGMARGVSLG