Protein Info for Pf6N2E2_1543 in Pseudomonas fluorescens FW300-N2E2

Annotation: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 67 to 86 (20 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details PF00501: AMP-binding" amino acids 15 to 335 (321 residues), 143.8 bits, see alignment E=3.4e-46

Best Hits

KEGG orthology group: None (inferred from 99% identity to pba:PSEBR_a2501)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z287 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Pf6N2E2_1543 Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3) (Pseudomonas fluorescens FW300-N2E2)
MSPEMERFKRTLRGHAERRGHAVALWGDGSQLDYATLYSEVVYRQQRLRDEHINVVALAL
DNGIEAMLWDLAALFEGLTCVILPGFFSQAQRRHCLEQSQAERVIAEPAFEAELQAAGYQ
HSGEFWRRHFDGPSRLPAGTAKLTFTSGTTGTPKGVCLSADSLLRVARELEQASQPVEAR
HHLALLPLAILLENLGCYAALYAGAMLSLPSQKTLGIQGASGVDPTRLLGCLAERRAQSL
ILVPQLLLMLVMAAEQKMFNPHIVRFAAVGGARVSHDLLQRAQRVGLPVFEGYGLSECAS
VVCLNRPQAHRAGSVGQPLPHVEIRLAEDGEVLIKGSTLLGYLGEPPHASEWWPSGDLGE
FDEDGFLYLRGRKKHQFVTSFGRNVNPEWVEAELTQGGDIAQAFVYGEAMPHNHALLWPA
RADCTDQTLELAVAKANDTLPDYARVHRWTRLDQPFSAANGMLTANGRPRREAIVEHYRA
QLTSSVLSEESPS