Protein Info for Pf6N2E2_1534 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details

Best Hits

Swiss-Prot: 50% identical to Y1892_XYLFT: UPF0394 membrane protein PD_1892 (PD_1892) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07112, (no description) (inferred from 94% identity to pba:PSEBR_a2509)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZXJ1 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Pf6N2E2_1534 Probable transmembrane protein (Pseudomonas fluorescens FW300-N2E2)
MIVHWRTLMNLDWLNFTPWSSLAGGMLIGLAAGLFVVANGRIAGISGLIGSLLQRGSEGV
GEKALFLLGLLVAPLVWGVFATLPPIEFQNGWFGLTVAGLLVGIGTRYGSGCTSGHGVCG
LSRLSPRSMVATACFMLSGFATVFVLRHVMGV