Protein Info for Pf6N2E2_1530 in Pseudomonas fluorescens FW300-N2E2

Annotation: Flagellar regulatory protein FleQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF08448: PAS_4" amino acids 2 to 102 (101 residues), 45.2 bits, see alignment E=3e-15 PF00158: Sigma54_activat" amino acids 114 to 281 (168 residues), 227.4 bits, see alignment E=2.6e-71 PF14532: Sigma54_activ_2" amino acids 115 to 285 (171 residues), 84.5 bits, see alignment E=2.5e-27 PF07728: AAA_5" amino acids 137 to 258 (122 residues), 31.4 bits, see alignment E=5.2e-11 PF00004: AAA" amino acids 138 to 257 (120 residues), 21.7 bits, see alignment E=7.2e-08 PF02954: HTH_8" amino acids 375 to 405 (31 residues), 27.7 bits, see alignment (E = 5.4e-10)

Best Hits

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2513)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVD5 at UniProt or InterPro

Protein Sequence (409 amino acids)

>Pf6N2E2_1530 Flagellar regulatory protein FleQ (Pseudomonas fluorescens FW300-N2E2)
MIVLDPDYNILAANTAYLRQFGSADKPFIGHKCYRVSHHYDVPCDQAGENCPMKKAREMR
SPDRVLHIHHTPRGPEHVDVELRPILNEHGVITAYVERLTQVRSASARPSNEGLVGSSPA
FNQALLELQRVAPSMLPVLLLGESGTGKELFARAVHETSERAAGPFVVVDCSGLTETLFE
SELFGHEKGAFTGATTRKVGLVETAQGGTLFLDEIGDVPLAMQVKLLRLIESGTYRRVGS
VETQHADFRLVAATHKPLEKMVEKGEFRQDLYYRISVFPIHLPPLRHRLEDIGLLVDSFL
QRSGIGKRRLTIDPEALMQLQRFAWPGNIRELRNVLERAALFADDGVIHALHLPAPPLAL
SAPALTPARDSRDLEQLVATFKGTRSELARHLGVSERTLYRRLKEQGLA