Protein Info for Pf6N2E2_1526 in Pseudomonas fluorescens FW300-N2E2

Annotation: MgtC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 120 (31 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 198 to 222 (25 residues), see Phobius details amino acids 231 to 254 (24 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 362 to 384 (23 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF02308: MgtC" amino acids 12 to 128 (117 residues), 51.1 bits, see alignment E=1.7e-17 PF13194: DUF4010" amino acids 177 to 386 (210 residues), 139 bits, see alignment E=1.8e-44

Best Hits

KEGG orthology group: None (inferred from 95% identity to pba:PSEBR_a2521)

Predicted SEED Role

"MgtC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV93 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Pf6N2E2_1526 MgtC family (Pseudomonas fluorescens FW300-N2E2)
MTESLAFANAAAALGIGLLVGLERERRKGEGDRRDFAGLRTFAITSVLGYLAVQAGGPLL
LGGVTLALGALVTVAYWRNLDKDPGITSEVALFAVLALGALCASAPGLATSIGVVMAGLL
ASRQTLHHFARNQLTATEMRDGLVLLIAALVVLPLAPDRFLGPYDAINLRNLCTLTVMLM
AVGALGHVAVRTLGTRYGYALSAIASGFASATATVATMGGIAAKEPINLKVVSAAAMLSN
LATVTQMGLILAAVDPALLRWMWGPLVCGMLMVLLYAGVLMFPRPRARADETIKHSGAFS
LKLAMTMVLAMAAITVLSSAMLDVFGQAGVTVTAIFSGLLDAHASTASIASLAKGGLLPF
DGVAVPVLMALSSNSLSKCVVAWLSGGRRFAAYVIPGQVLVTLAMWAGLLFPSLSA