Protein Info for Pf6N2E2_1517 in Pseudomonas fluorescens FW300-N2E2

Annotation: Arginine/ornithine antiporter ArcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 118 to 143 (26 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 301 to 330 (30 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 420 to 435 (16 residues), see Phobius details amino acids 441 to 459 (19 residues), see Phobius details amino acids 471 to 491 (21 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 29 to 497 (469 residues), 561.4 bits, see alignment E=1.7e-172 TIGR03810: arginine-ornithine antiporter" amino acids 31 to 497 (467 residues), 612.5 bits, see alignment E=4.7e-188 PF03845: Spore_permease" amino acids 32 to 282 (251 residues), 31.1 bits, see alignment E=1.8e-11 PF13520: AA_permease_2" amino acids 32 to 436 (405 residues), 211.5 bits, see alignment E=3.3e-66 PF00324: AA_permease" amino acids 41 to 426 (386 residues), 49.8 bits, see alignment E=3.5e-17

Best Hits

Swiss-Prot: 59% identical to ARCD_PSEAE: Arginine/ornithine antiporter (arcD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 98% identity to pba:PSEBR_a2530)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZWD5 at UniProt or InterPro

Protein Sequence (497 amino acids)

>Pf6N2E2_1517 Arginine/ornithine antiporter ArcD (Pseudomonas fluorescens FW300-N2E2)
MATHLQGTEPVIPTVTPHPLAGSLRKVEPRRLSLSLLIALVVGSMIGSGIFSLPQNMAAS
AGAGAILIGWLITGVGMLSLALVYQTLSNRQPELDNGVFAYARALGGEFLGFNSAWGYWI
SAWIGNVSYLVILFAALSYFFPVFGEGNNKAAIVGASVVLWALHWMILRGMRTAAKANAL
TTIAKVVPLLLFIGLVIAAFSKDTFMVDFWGTPALGSTLDQVKSTMLVTVWVFIGIEGAN
VFSARAAERADVGRATVIGFILTLMLLIAVSLLSLGILRQPELAALKNPSMAGVLEAVAG
PWGAVLISIGLIVSVGGALLAWTLLAAESVFTPAKEKVMPRLLATENQHGAPANALWITN
GCIQLFLLLTLYSSASYLALISLATSMILLPYLFSGLYALKMTWQGQTYAGHRGLQLRDM
AIAVVATGYCVWLLYAAGPRYMLLSALLYAPGSLIYLSAQRARTGRALTGFGWGLLLVIW
AAAIFAGWMLWSGQLTL