Protein Info for Pf6N2E2_1516 in Pseudomonas fluorescens FW300-N2E2

Annotation: transcriptional regulator, Crp/Fnr family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00027: cNMP_binding" amino acids 48 to 130 (83 residues), 55.1 bits, see alignment E=9.2e-19 PF13545: HTH_Crp_2" amino acids 166 to 239 (74 residues), 57.3 bits, see alignment E=1.8e-19 PF00325: Crp" amino acids 191 to 221 (31 residues), 24.5 bits, see alignment 2.7e-09

Best Hits

Swiss-Prot: 48% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 98% identity to pba:PSEBR_a2531)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZV86 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Pf6N2E2_1516 transcriptional regulator, Crp/Fnr family (Pseudomonas fluorescens FW300-N2E2)
MAESEPRLLHVHALKTACSNCSVLELCLPIGLTGGEVERLDTLIAQRVKVKKGAALYRTG
DPLRSLYAVRLGFFKTSVLSVDGREQVTGFQMQGEMLGLDAISTDRYACNAIALEDSEVC
PLPFNLLEKLAHDLPSLQHNLNKLLSQEIVRDHGMLLMLGNMNADERLAAFLLNLSQRLN
MRGYSSREFVLRMSREAIGSYLGLRLETICRGIAHLRQEELVDMHGRNVTILDLPGLKQK
VAGCHRHAEL