Protein Info for Pf6N2E2_1503 in Pseudomonas fluorescens FW300-N2E2

Annotation: Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 PF13188: PAS_8" amino acids 26 to 74 (49 residues), 16.3 bits, see alignment 3e-06 amino acids 157 to 208 (52 residues), 17.2 bits, see alignment 1.6e-06 amino acids 279 to 331 (53 residues), 20.6 bits, see alignment 1.3e-07 amino acids 407 to 451 (45 residues), 26 bits, see alignment 2.6e-09 PF13426: PAS_9" amino acids 34 to 141 (108 residues), 21.6 bits, see alignment E=8.7e-08 amino acids 167 to 258 (92 residues), 28.4 bits, see alignment E=6.5e-10 amino acids 291 to 391 (101 residues), 31.3 bits, see alignment E=8.4e-11 amino acids 416 to 522 (107 residues), 28.3 bits, see alignment E=7e-10 TIGR00229: PAS domain S-box protein" amino acids 154 to 245 (92 residues), 38.1 bits, see alignment E=7.5e-14 amino acids 275 to 400 (126 residues), 63.8 bits, see alignment E=8.6e-22 amino acids 401 to 529 (129 residues), 45.9 bits, see alignment E=2.9e-16 PF00989: PAS" amino acids 156 to 249 (94 residues), 26.2 bits, see alignment E=2.7e-09 amino acids 279 to 390 (112 residues), 35.7 bits, see alignment E=3e-12 amino acids 406 to 442 (37 residues), 27.1 bits, see alignment 1.5e-09 PF08448: PAS_4" amino acids 288 to 395 (108 residues), 27 bits, see alignment E=1.9e-09 amino acids 411 to 525 (115 residues), 39.9 bits, see alignment E=1.7e-13 PF07568: HisKA_2" amino acids 536 to 586 (51 residues), 30.3 bits, see alignment 1.4e-10 PF07536: HWE_HK" amino acids 536 to 617 (82 residues), 92.2 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: None (inferred from 94% identity to pba:PSEBR_a2548)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z1V5 at UniProt or InterPro

Protein Sequence (727 amino acids)

>Pf6N2E2_1503 Chemotaxis protein methyltransferase CheR (EC 2.1.1.80) (Pseudomonas fluorescens FW300-N2E2)
MSNIEELPRETRTPSEYESLIAMGTSALDAIPGAVYLCDRKGGLVRYNSEAAELWGRAPA
LGENGDRFCGAHRLFLTDGRPLAFEHCPTALALNTGIASRNQEVLIERPDGSRFVALMNI
RALKDCRGVIQGVINCFQDVSAHHAMAEELRRKSADLEDFFENSAVGLHIVSSEGIILRA
NKAELALLGYSADEYIGRHITEFHVDEPVIGDILTKLGSGDCLQSYPARLRAKDGSIKHV
MITSNGRFEDGKLFNTRCFTIDRSGVHAAEAARQDSDDRLSATYEAATIGIAEADVDGRL
LRVNDALCNMLGRSREQLLSMTFLDYTHPDCIPQDAGLYARQVAGELDNYVLRKRAVKPD
GEVVYLDIHSSSVRDANGTFRYGVRVLQDVTLARRMENQLRESERHMRNLLEALPAAVYT
TDADGRITFYNRAAVELSGRTPHLGDMWCVTWKLFNTDGTALPHDQCPMAVALKENRPIR
GVEAVAERPDGSRVPFTPYPTPLHDADGNLVGAINMLVDISERKQAENRQKTLIDELNHR
VKNTLATVQSLAAQTARNAEDAKDGYRRFEARLLALSRAHDLLTKRHWGQTPLDTLAHEV
LMPVFGHEPGRIVIEGPSADVGTRVALNLTMTLNELAINALKYGAMSVESGTLAVTWHLQ
ARTGGTLLTLDWSEQGGPPVSPPEREGLGSRLMQRCIERDLAGKFDLTYAPQGVCCRFSF
LIGVTGA