Protein Info for Pf6N2E2_1499 in Pseudomonas fluorescens FW300-N2E2

Annotation: ABC transporter amino acid-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 252 (210 residues), 112.8 bits, see alignment E=9e-37

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 87% identity to pfs:PFLU2230)

Predicted SEED Role

"ABC transporter amino acid-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z1U2 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Pf6N2E2_1499 ABC transporter amino acid-binding protein (Pseudomonas fluorescens FW300-N2E2)
MLLERSPVKRLLPVMLGALISLSAANIARADATLDKIEQRHELVVGVLLSGGPFGGIDPV
NQKPRGFNVDLAQELGRQLGAEVQLVPVLPANRVQFLQQGKVDVLIANMEWTAERGEILG
FVPTPFYRVGGTAAVLKDSMISRWEDLKNQPVCTSQGSSYIKPLTELGVQIKAFKSSSES
LLALRGNNCVAAVHDATLINPLIADNAEWQGYRALSPELNPAPSVIWTRKGESDTQARLD
PIIKQLHRSGWLIDAQTRNRITPASPALVELQKQFQASGA