Protein Info for Pf6N2E2_1486 in Pseudomonas fluorescens FW300-N2E2

Annotation: Multidrug resistance ABC transporter ATP-binding and permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 619 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 40 to 307 (268 residues), 72 bits, see alignment E=6.9e-24 PF00005: ABC_tran" amino acids 377 to 531 (155 residues), 125 bits, see alignment E=3.4e-40

Best Hits

Swiss-Prot: 58% identical to Y1051_HAEIN: Uncharacterized ABC transporter ATP-binding protein HI_1051 (HI_1051) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 98% identity to pba:PSEBR_a2556)

Predicted SEED Role

"Multidrug resistance ABC transporter ATP-binding and permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVR5 at UniProt or InterPro

Protein Sequence (619 amino acids)

>Pf6N2E2_1486 Multidrug resistance ABC transporter ATP-binding and permease protein (Pseudomonas fluorescens FW300-N2E2)
MLRVFEQRLDPFPPDEVPPPPEGLARFLWACTRGARGYILAFALLSAGVSIYEAWLFSFL
GQVVDLLSTWQAGGEAAAQEGRVLWGMGIVMLASIGLVALRTMVQHQVLAINLPLRLRWD
FHRLMLRQSLSFFSDEFSGRVTTKVMQTALAVRDVLFTLIEIAPGIGVYFIAIIALAGGF
ALKLMLPFLAWIVLFGLAMLYFVPRLGKVGQEQAHARSSMTGRISDAYTNITTVKLFSHS
NREAHFARAAMEDFKQTGFRQMRLVSQFEIVNQALVVGLIMAAGGYALWLWHQGEVGAGA
VAAITAMALRINGMSHWIMWQMTSLFESIGTVQDGMATLTRGPKVQDAPDAGVLVTSGGA
VTFDNVSFNYNGERQVLDGLSLNIRPGEKIGLVGRSGAGKSTLINLLLRFYDVDSGQIRI
DGQDIAHVTQDSLRSAIGMVTQDTSLLHRSIGENIAYGRPDASDAQIRRAAANAQADEFI
SQLSDRQGHTGYDTLVGERGIKLSGGQRQRIAIARVMLKNAPILLLDEATSALDSEVEVA
IQESLDEMMQGKTVIAIAHRLSTIAAMDRLIVMDDGRIIEQGTHAELLAKNGIYARLWQH
QSGGFLGEDQWVTEAMDQV