Protein Info for Pf6N2E2_1484 in Pseudomonas fluorescens FW300-N2E2

Annotation: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR01851: N-acetyl-gamma-glutamyl-phosphate reductase" amino acids 4 to 306 (303 residues), 402.8 bits, see alignment E=5.1e-125 PF01118: Semialdhyde_dh" amino acids 45 to 104 (60 residues), 45.5 bits, see alignment E=9.6e-16 PF22698: Semialdhyde_dhC_1" amino acids 117 to 289 (173 residues), 105 bits, see alignment E=4e-34

Best Hits

Swiss-Prot: 71% identical to ARGC_BURL3: N-acetyl-gamma-glutamyl-phosphate reductase (argC) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K00145, N-acetyl-gamma-glutamyl-phosphate/N-acetyl-gamma-aminoadipyl-phosphate reductase [EC: 1.2.1.- 1.2.1.38] (inferred from 95% identity to pba:PSEBR_a2561)

Predicted SEED Role

"N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)" in subsystem Arginine Biosynthesis extended (EC 1.2.1.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.-, 1.2.1.38

Use Curated BLAST to search for 1.2.1.- or 1.2.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165Z1Q8 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Pf6N2E2_1484 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) (Pseudomonas fluorescens FW300-N2E2)
MASPLVFIDGDQGTTGLQIHQRLRERNDLRLFTLSPEHRKDPQRRAEAINHCDIAVLCLP
DQAARDAVATIENSAVRVIDASSAHRTQPDWAYGFAEMNPQQAQRIAAARRVSNPGCYPT
GAIGLLRPLLEAGLLPRDYPLNIHAVSGYSGKGRVGVQEHEGAGAAQASAFQVYGLGLAH
KHVPEIQQQSGLTQCPMFVPAYGAFRQGIVLTIPLHTRLLAPGVSAVQLHGCLMQHYADA
RHVQVMSMQEAKALTSLDPQALNGTDDLRLSVFDNDEAGQVLLAAVFDNLGKGAAGAAVQ
NLNLMLAGA