Protein Info for Pf6N2E2_1482 in Pseudomonas fluorescens FW300-N2E2

Annotation: Probable periplasmic spermidine/putrescine-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF01547: SBP_bac_1" amino acids 45 to 301 (257 residues), 55.3 bits, see alignment E=2.2e-18 PF13416: SBP_bac_8" amino acids 45 to 320 (276 residues), 111.2 bits, see alignment E=1.6e-35 PF13343: SBP_bac_6" amino acids 77 to 326 (250 residues), 55.7 bits, see alignment E=1e-18

Best Hits

Swiss-Prot: 45% identical to POTF_ECOLI: Putrescine-binding periplasmic protein (potF) from Escherichia coli (strain K12)

KEGG orthology group: K11073, putrescine transport system substrate-binding protein (inferred from 96% identity to pba:PSEBR_a2563)

MetaCyc: 45% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Probable periplasmic spermidine/putrescine-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZTU8 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Pf6N2E2_1482 Probable periplasmic spermidine/putrescine-binding protein (Pseudomonas fluorescens FW300-N2E2)
MRKSHLRTIFSASLLCAGISTSVAAVEPGMYLYNWFGLLAPETPKEFEQETGTRVHMDAF
DSAEIMQSKVMAGRTGYDVVVATSNVLPSLIRAGVLQPLDRSQLSNFSHIDPDLLSQLAV
NDPGNRYAVPYLWGTTGIGYDVDKVRGALGDNAPVNSWDLIFKEENISKLQSCGVAMLDS
PSEIISIALNYLGLPSNSKNPDDYQKAQALLLKIRPYVLYFDSSKIDADLADGNICAVVG
WANGALAAQAINEKANTGRKIAYSLPREGALSWSENLVLLKDAPHPKEGMAFINYMMRPE
VIAKTSNHTLYPNANKDAAEFVERKLRDNPWIYPDKKTIATLIPLEPLPLKLERIRTRIW
TKVKSGV