Protein Info for Pf6N2E2_1481 in Pseudomonas fluorescens FW300-N2E2

Annotation: VgrG protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 TIGR03361: type VI secretion system Vgr family protein" amino acids 10 to 439 (430 residues), 405.8 bits, see alignment E=2.6e-125 TIGR01646: Rhs element Vgr protein" amino acids 21 to 439 (419 residues), 227.5 bits, see alignment E=3.5e-71 PF05954: Phage_GPD" amino acids 29 to 310 (282 residues), 201 bits, see alignment E=1.3e-63

Best Hits

KEGG orthology group: None (inferred from 90% identity to pba:PSEBR_c2g55)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A159ZVA1 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Pf6N2E2_1481 VgrG protein (Pseudomonas fluorescens FW300-N2E2)
MFSPANQTHFSLTIEGFEHDFQVLAFTGKEAISRPYLFNVEFVSERSDLDLKSLFDVEAF
LTFDSKGNGIHGRVYHIAHSSNGECLTRYRLALVPHLAYLRHRINQRIYQQFSVPKIVAL
ILEEHGILGDAYRFHLGATYPERDYCTQYDETDLHFIQRLCEEEGIHFHFQHSTQGHVLV
FGDDQSVFPSIGQPTAYRHESDRVADEPLIKRINLRLGQLTSRISHRNYDFEQQLDIEKD
DSSQRYTGHEHGKQIRLRTMERRHAAYRQAEGQSDQTRLVSGHVLEISGHPRQEWNTLWL
LTQVIHEGRQPQVLGENVARGNTLNEDDFHQGYRNRFVVLPWNVSYRPPLAHKKPQVPSM
QTAVVVASEGEGIQNDRCFGQIKVKFPWDREDRFDDKSHCWLKGATDWSCEIGPPRMGMK
VVVTFLENDPDQPVVGGCLCCR